SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_6339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  366394.Smed_6339
Domain Number - Region: 41-104
Classification Level Classification E-value
Superfamily POZ domain 0.0044
Family Tetramerization domain of potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_6339
Sequence length 117
Comment (Sinorhizobium medicae WSM419)
Sequence
MFRLGADLKVYLHREPIDFRAGINSLAVLVQETMALDPFAPAVFAFCNRRRDRMKLLFFD
RSGFVLVLKRLTEDKFRWPRREVAVVTLTTEQLHWILDGIDIDAMVRHPVRQYQVAG
Download sequence
Identical sequences A6UMQ2
YP_001314865.1.44884 gi|433611207|ref|YP_007194668.1| gi|433616024|ref|YP_007192819.1| gi|150378271|ref|YP_001314865.1| gi|150378271|ref|YP_001314865.1|NC_009622 gi|433611207|ref|YP_007194668.1|NC_019849 gi|433616024|ref|YP_007192819.1|NC_019848 366394.Smed_6339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]