SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_0041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366602.Caul_0041
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-54
Family Ribonuclease PH domain 1-like 0.0000186
Further Details:      
 
Domain Number 2 Region: 296-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-49
Family Ribonuclease PH domain 1-like 0.0000137
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.62e-29
Family Ribonuclease PH domain 2-like 0.00079
Further Details:      
 
Domain Number 4 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 610-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.39e-20
Family Cold shock DNA-binding domain-like 0.00043
Further Details:      
 
Domain Number 6 Region: 554-631
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.69e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 7 Region: 239-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000259
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_0041
Sequence length 716
Comment (Caulobacter K31)
Sequence
MFEIMRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKKAKPGQDFFPLT
VNYIEKTYAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVCTVLQH
DLENDPDIVAMCAASAALVISGAPFMGPIGGCRVGYVNDEYILNPTLDELKESKMDLVVA
GTADAVMMVESEIQELSEEIVLGGVSFAHKSMQAVINGIIELAEHAAKEPFDFQPEDTDA
LKAEVKKAVGADLADAYTIRAKGDRHAALSAAKSKAVDTFAKSDANPAGIDPLKLISVFK
ELEADIVRRSILDTGIRIDGRTVDTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGT
GDDEQFIDALEGTYKEAFLLHYNFPPFSVGETGRMGSPGRREIGHGKLAWRALRPMLPAK
EDFPYTIRLVSEITESNGSSSMATVCGASLAMMDAGVPLIRPVSGIAMGLILEKDGFAVL
SDILGDEDHLGDMDFKVAGTSQGLTSLQMDIKIAGITEEIMKQALAQAKGGREHILGEMN
KAMDAPREEVGDYAPKIETITIPTDKIREVIGTGGKVIREIVATTGAKVDINDEGTVKVS
ASDGAKIKAAIDWIKSITQEAEVGAIYDGKVVKVVDFGAFVNFFGAKDGLVHVSQISNER
VAKPSDVLKEGQIVKVKLLGFDDRGKTKLSMKVVDQETGEDLSKKEAVSPEEAVNT
Download sequence
Identical sequences B0T175
366602.Caul_0041 gi|167644014|ref|YP_001681677.1| WP_012284137.1.20905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]