SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_3421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  366602.Caul_3421
Domain Number - Region: 53-157
Classification Level Classification E-value
Superfamily NHL repeat 0.0051
Family NHL repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_3421
Sequence length 187
Comment (Caulobacter K31)
Sequence
MSKLAVGLMATLIASTSIVATASAQDRGPPRDGLAGGPGPGRPMPCGAPLTGEAPDVMTY
DRATGTQVFVGGKGQTEVSAFNRDTGSSAALRGDLSRPGVAEACAVDRLSGDAYRVNSDG
PGDMAISGRTGRTGERWAFRAPDGSTQYWDPRADNRCFREGLGLGPNGSLPSGPRPDSRD
GAGRSGC
Download sequence
Identical sequences B0T5W7
gi|167647383|ref|YP_001685046.1| 366602.Caul_3421 WP_012287445.1.20905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]