SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_4230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366602.Caul_4230
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.92e-34
Family HSP20 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_4230
Sequence length 105
Comment (Caulobacter K31)
Sequence
MDLAETKEGFELTVEVPGLDEKDVQVTVSDGQLTVTGEKKFETEQKDKTYRLVERGYGSF
SRSIALPAGVKEDDIKATLDKGVLKVVVPTPDKSEPKKIAVTKAG
Download sequence
Identical sequences B0SYI5
gi|167648187|ref|YP_001685850.1| 366602.Caul_4230 WP_012288238.1.20905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]