SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 367737.Abu_1183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  367737.Abu_1183
Domain Number 1 Region: 310-507
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-39
Family Ribonuclease PH domain 1-like 0.00014
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-38
Family Ribonuclease PH domain 1-like 0.0002
Further Details:      
 
Domain Number 3 Region: 470-562
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-25
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 143-253
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.19e-20
Family Ribonuclease PH domain 2-like 0.0048
Further Details:      
 
Domain Number 5 Region: 649-722
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.7e-16
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 6 Region: 573-672
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000614
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 367737.Abu_1183
Sequence length 725
Comment (Arcobacter butzleri RM4018)
Sequence
MSKVCEFELNGKQEIFEFEKVAKQSNGAVLAKIGNAVVLATVVSEFDNPVSEDFTPLTVQ
YIEKTYAAAKLPGGFIKREGKPSDFETLTSRVIDRSLRPLFPKGYVYPTTITVMVLSADK
NVDLQTLSLNAANAALYTSNLPIKKSVCGVRVGKIENTLVINPTNEQLENSTLDLYVAGS
KEELLMIEMKTISSSELVEIDIEAFTKIHNTNEMDEDALVEAIAFAQNALKEANLTYEKA
FEEVSKEKFEVELVKFTIEESVINYVRDNFSNDIKEAIKKLAKSERATQLKDVAKMISKN
EYCISNEIEFNTIYEAVSVVKREIVRAMIVNERVRADGRGLKDVRPISIETNILPSTHSS
CLFTRGETQALVIGTIAGPKDGQMYEVLTDKSTSMENFMVHYNFPGFSVGEAKPMFGVGR
RELGHGNLAKKALEATIDKDYNETVRLVSEILESNGSSSMATVCGGSLALKAAGIPISDL
VAGVAMGMVVENDKYAILTDIMGLEDHDGDMDFKVAGTSKGITALQMDIKLGGIELSVLK
EALLQAKEGRTHILSLMKDAEKDIVPSGALPLIEQFAIDPSKIMVVIGKAGATIKEIIEK
FTVSIDLDKENGTVKVSGGNKQNIIDACEHIKTISNNAPSKKDASKNIDFEKLYSEDEVV
IGKVERLADFGAFILLPKGGEGLLHISKISKDRVKNVADVLSIGQELEVKVLKVKKDRIE
LSSAN
Download sequence
Identical sequences A8EU19
WP_012012877.1.47628 367737.Abu_1183 gi|157737429|ref|YP_001490112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]