SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 367928.BAD_0260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  367928.BAD_0260
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.9e-45
Family Ribonuclease PH domain 1-like 0.000000683
Further Details:      
 
Domain Number 2 Region: 327-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-42
Family Ribonuclease PH domain 1-like 0.00000116
Further Details:      
 
Domain Number 3 Region: 153-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.94e-25
Family Ribonuclease PH domain 2-like 0.0000217
Further Details:      
 
Domain Number 4 Region: 481-579
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.94e-23
Family Ribonuclease PH domain 2-like 0.0000278
Further Details:      
 
Domain Number 5 Region: 589-676
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.86e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 266-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.59e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 7 Region: 652-732
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.86e-16
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 367928.BAD_0260
Sequence length 892
Comment (Bifidobacterium adolescentis ATCC 15703)
Sequence
MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDDSMILSTTTAGSSPKE
NYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIIDRPLRPLFPHTLRNEVQ
VVETVLAVNPDDAYDVVALNAASASTMISGLPFEGPVSGVRLALIDGQWVAFPRWSERER
AVFEIVVAGRVVENGDVAIAMIEAGAGKNAWHLIYDEGQTKPDEEVVAGGLEAAKPFIKV
ICEAQAELKKIAAKETKEFQLFPEYTEDLYNRIDEIAHADLDEALSIAEKLPRQDRIHEI
KEGVKATLAGEFTDMEDAEKDKEIGNAFKELQRQIVRRRILTQDYRIDGRGLRDIRTLSA
EVDIVPRVHGSALFQRGETQILGVTTLNMLKMEQQIDALSGPQSKRYMHNYEMPPYSTGE
TGRVGSPKRREIGHGALAEKALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTLS
LLAAGVPLKAPVAGIAMGLVSGDVDGQHIYKTLTDILGAEDAFGDMDFKVAGTSEFITAL
QLDTKLDGIPADILASALQQAKEARTTILEVINECIDGPAEMSPYAPRIITTTVPVDKIG
EVIGPKGKMINQIQEDTGAEIAIEDDGTVYISSEGGEAAEKAKEIIDQIANPHVPEAGET
YNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLKEGDTVEVVVQGVD
DRGKISLAIPGFEDQESSAPRRDRGDRDDRRGGRGRRDDRRRSDDRDDRDYDDRPRRRRS
DRDDDRDYDDRPRRRRSDRDDRDYDRDDRRSSRSDRDDRDYDDRPRRRRSDRDDRDYDRD
DRRSDRRRGSRRDDRNPRYAADENYDEYRADREERSERPRRRVRRDFDPFED
Download sequence
Identical sequences A0A087DLP0 A0A0B5BLA7 A1A008 A7A3V0
gi|119025278|ref|YP_909123.1| WP_003807809.1.16084 WP_003807809.1.24652 WP_003807809.1.31140 WP_003807809.1.31393 WP_003807809.1.36503 WP_003807809.1.38945 WP_003807809.1.41253 WP_003807809.1.43097 WP_003807809.1.47152 WP_003807809.1.51786 WP_003807809.1.55963 WP_003807809.1.6218 WP_003807809.1.64668 WP_003807809.1.68247 WP_003807809.1.81525 WP_003807809.1.90122 WP_003807809.1.92700 WP_003807809.1.95811 367928.BAD_0260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]