SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 368407.Memar_1724 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368407.Memar_1724
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-32
Family FAS1 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 368407.Memar_1724
Sequence length 143
Comment (Methanoculleus marisnigri JR1)
Sequence
MKSILATLRESGSFDVFLDLVRTAGMEERLSTEGPYTLFVPDDDAFHEISRPELEAIRRN
ADRLGDTLNYHIVPGVHSMIDLLGIRTLRSLQGGDLAVEVAPEGVLVNDVAVVEADAWCT
NGICHAVSALLLPPVARAVAVHG
Download sequence
Identical sequences A3CWA1
gi|126179668|ref|YP_001047633.1| 368407.Memar_1724 WP_011844562.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]