SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36870.WGLp222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36870.WGLp222
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-46
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 2 Region: 298-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-43
Family Ribonuclease PH domain 1-like 0.0000279
Further Details:      
 
Domain Number 3 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-24
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-21
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 5 Region: 555-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 6 Region: 240-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000136
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0044
Further Details:      
 
Domain Number 7 Region: 620-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000359
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36870.WGLp222
Sequence length 705
Comment (Wigglesworthia brevipalpis)
Sequence
MLKATIQKFQYGKNIVTIETGMIARQATSAVMVRMDDTSVFVTVVADKKEKLGQKFFPLT
VNYQERTYSIGRFPGGFFRREGRPNENEVLVSRLIDRSVRPLFPKNFFNDIQIIATVMSV
NPQVNPDIVSIIGASAALSLSGLPFKCPIGSSRIGYIDNKYILNPTTSELIDSKLDMIVS
GSSNAVLMVESSSNILQEKNILEAILFGNEQNKIVIENIDKLKKKFKKENLEYDLKSLNN
NDIQFVIEDLFFDRIKDSYKIPEKKKRLEKIENIKNDILNNFINNNNTNEEEILYIIQNI
ERKIVRNRIISGKPRIDGRTEDMVRNLDIHLGILPRTHGSSLFTRGETQALVTTTLGTER
DAQNIDDLVGDKIDRFLFHYNFPPYCVGEVGIISSPKRREIGHGKLAKRGMLAVMPDIDK
FPYTIRIVSEITESNGSSSMASVCGASLSLMDAGVPISSSVAGIAMGLIKEKDKFVVLTD
ILGDEDYLGDMDFKVMGTREGVTALQMDIKIEGITSEILQVSLDKAKNARINILNEMDKV
IKKPKNEISIFAPRIYKIKINPEKIKDVIGKGGSVIRMLTEKTKSSIEIEDDGTVKVIST
DIKNAQCALKKIKDITHEIKINKIYVAKITRISEFGIFACLINNKEGLIHVSKIPYKKFS
DINNNFKIGQIISVKVIEIDRYGRIRLSFTGTDKNKNKKFFNKNN
Download sequence
Identical sequences Q8D2Y0
36870.WGLp222 gi|32490971|ref|NP_871225.1| WP_011070026.1.19188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]