SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5DU10 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5DU10
Domain Number 1 Region: 87-161
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.53e-29
Family Skp1 dimerisation domain-like 0.0000266
Further Details:      
 
Domain Number 2 Region: 5-69
Classification Level Classification E-value
Superfamily POZ domain 3.06e-17
Family BTB/POZ domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36914.A5DU10
Sequence length 164
Comment (Lodderomyces elongisporus)
Sequence
MSSPKVIIVSSDDEKFPVEQKVAEKSILMKNMINDLNPDGLTEDFEIPTPNVRANVLSKV
LEWCEHHKNTVFQDDEDEDAKKSVPVEEWDRNFLKVDQEMLYEIILAANYLNIKPLLDSG
CKMVAEMIKSKSPEELRRTFNIVNDFSPEEEAAIRKENEWAEDR
Download sequence
Identical sequences A5DU10
XP_001528326.1.59662 LELT_00846 36914.A5DU10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]