SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5DU63 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5DU63
Domain Number 1 Region: 120-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 
Weak hits

Sequence:  36914.A5DU63
Domain Number - Region: 77-134
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0667
Family Gametocyte protein Pfg27 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36914.A5DU63
Sequence length 363
Comment (Lodderomyces elongisporus)
Sequence
MPSTHNADKPWDTPDIDKWAIEEFKEEHNASGEHFAEESLFMTLFPKYREQYLRNIWSYV
TKALDKHHIRCELDLVEGSMTVKTTTKTFDPAMIIKARDLIKLLARSVPFPQAVKVLQDD
IACDVIKIGNFVTNKDRFIKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
KEVRRVVEDCMKNIHPIYYIKELMIKQELSKNPELANEDWSRFLPSFKKRNVARKKKTSK
KDGEKKVYTPFPPAQQPRKIDLQIESGEYFLGKKERELKKIQEKRSKQEENSELKRQERA
KDYVAPEESEYENKLLNQDKKEKKEKKDKKDKLDKKEKKSKRKSSEDGDDNEEKKLKKSK
KSS
Download sequence
Identical sequences A5DU63
LELT_00899 36914.A5DU63 XP_001528379.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]