SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5DWU5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5DWU5
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily POZ domain 1.02e-28
Family BTB/POZ domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36914.A5DWU5
Sequence length 99
Comment (Lodderomyces elongisporus)
Sequence
MASSNTEFVTLVSSDKFKFVIQKDVAAISSVLRNSQGFEEGKTGKIELDMDGDILECVVE
YLYYHFKYKDQVESGDVPEFHIPTHLALELLVKADYLDI
Download sequence
Identical sequences A5DWU5
LELT_01832 XP_001527003.1.59662 36914.A5DWU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]