SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5DYG5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  36914.A5DYG5
Domain Number - Region: 111-150
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 0.0298
Family Patatin 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36914.A5DYG5
Sequence length 188
Comment (Lodderomyces elongisporus)
Sequence
MNLNNGLWGVYQGPQPPPKALLEMTQEEQAEAGAQQFISFMQSCPGKTAMAGVSGFALGG
FFGLFMASMAYDVPVGTDSVKHISELPFKQQMKLQFGDMAKRSYSSAKNFGYIGLVYSGV
ECAIESFRAKHDLYNGVSAGCITGAGLAIKAGPQAAFVGCAGFAAFSLAIDTYLNSDSTY
PPKNDYDT
Download sequence
Identical sequences A5DYG5
LELT_02402 36914.A5DYG5 XP_001525844.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]