SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5E1J7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5E1J7
Domain Number 1 Region: 994-1084
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000264
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 852-942
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 680-771
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 4 Region: 765-850
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000877
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 5 Region: 175-232,279-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Weak hits

Sequence:  36914.A5E1J7
Domain Number - Region: 353-433
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000101
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number - Region: 592-677
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 
Domain Number - Region: 933-967
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0177
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36914.A5E1J7
Sequence length 1109
Comment (Lodderomyces elongisporus)
Sequence
MPSPAEIIAARLNRDSEDYELKQELEYKNVDDAVSTTSSTRASTPSITDESAFPALGMKS
SNGSGAGAGAGAASTHATTNWGPTMKSPKGVDPASLPSNDPARQAANVKKSTFYPKMRAH
QPSVQEAFSLDIEDQLNVSRPEFVKILTFVMQETKTSIECTNSQHTKKRTFLITGKPEEV
KSAKRLVVKKLTKPISIKFTVPAALRSRIIGQGGKNLKPIIAANEVKIEIGEEEHDAKNE
NVSTKNDEDSNFVNNKEQEDDEEEEEEDDDDDIFSKTIQITIDGDVEGAKRAKSQILAIV
KEETKNLSTKVSLDERVKPFAITELKSLVDKYSDLDFSIPDYKSSRTSLLIVGERESVLE
AKSDVKAALEKLSKKITVEEVPIPQTKHQFLPIADVLEKCNVLIQLPKDGEQNVKFVGEK
KNIKLAQDEARKVTSQYKVEVLDMSKAHKGNLKHVRAVAVLLNKTGAFKEIAQTNDVTIH
VPHAKELQGESSTTSSIPIQIVSKSGDDKIKAARKAIVTQVNKITPEQTKVIDDIDAFFQ
GKIEETIKDVAKAENVQYVILGTTITLFSAQQKQDEEADDFDDFETADVDQGAFDKINTA
LTDLRQLAAKLTSESLKASQKEIQVVFGPKGTTLKSILASVEPQTVTVKFNENLINIHGI
DSSVVQVKKEIEAVLAEAKEYPDGYSSTVQVPASVVSRLIGRNGANLNALRDEFGVKIDV
PLLANGNVASSASHGKDDGEKVEITVKGVKKNVEEAKANISASAKKWADETLVRLRIEHQ
YHRRMIGAQGVYINRLQDKYHVKIRFPSADSSSSAQSTFADAPKSKDEVTIKGPSKMVAK
AEEELKELYKFEQENGYKETIRIPSKAISRVIGKAGATINDIADGTGVEYKFKRDNAASE
EKDGFVEVELTGSKSALKEAKAKIQEIIADVENFVVETVKVDPKYHRDLVGPYGSVMKHI
ITQAGGDNLPRQKYNRLMSIPNEGSGSDEVVCQGDKAIVEKIVQAIEKIVEEKKATISED
YELAKEKHRFIIGPGGSTRSEIEREFKVQLSIPKREDESIVVKIKGLPENIEKAKLKITE
LTKDKETKNGKKNKSNGESKEKEAVEVEN
Download sequence
Identical sequences A5E1J7
36914.A5E1J7 XP_001525556.1.59662 LELT_03484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]