SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5E3F5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5E3F5
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000206
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36914.A5E3F5
Sequence length 229
Comment (Lodderomyces elongisporus)
Sequence
MVEMEPRRSARANKGVHTKRELEEYQVGGVEKTGSHKLSTKNEVKKDHEKVPTTVKKEKI
KEEVKDKVFDSNDDNNSVENEDNEEVRCTPCGATTENYDEENDTLGDMILCDKCKTWQHI
KCMGYRKNNVPKVYQCDICSGEPRPANVKQQQQQQQQKNKKKRAQQLETVLETDSATKKQ
KTSSSTPEEKEPLEQEEIVTIESLKNPLRLCTCKGLFQIFPEKASPLKQ
Download sequence
Identical sequences A5E3F5
XP_001525110.1.59662 36914.A5E3F5 LELT_04142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]