SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5E5U3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5E5U3
Domain Number 1 Region: 325-405
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.99e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00097
Further Details:      
 
Domain Number 2 Region: 410-487
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 647-725
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000102
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36914.A5E5U3
Sequence length 733
Comment (Lodderomyces elongisporus)
Sequence
MSDVSPPNDGSNNVLKRKNEDSESIEGSINGDGIPVKQTKRVAFNPEELDLQGEEEDKKH
TAPTIGILIDSAVDSNAAANAEDTEDTANEENIGKTEAETEAEAEAQADVDVDVDVDVDA
ENEQTDQGDEATDIVKDESEPVSSSEGGKNEDIEDNESKEQSKEQSSSDSVSKNEEEDSK
DTNTSTSEKPAFGQAQTVQQILQQAALLSDLAPTPASAPEQKSSASGASDNSGASGNSGD
SGLSGHSGESDVPNVPNVPNVPSAPKDFKHPRDSRDSRDSRGSRDFRDSRDSFGSVASAQ
LPAAPTRASGSNSDYRSLSSSSKPFHVEDDASFISVRIICPVKEASTIVGKQGSKINHLR
EKANVRIQVSENIRDVPERIVTVRGTPENIARAYGLIVRTILSEPEDEPANINSQQYTLK
LLIPHALIGFLIGKQGSKFREIEENSAAKLKAAEQPLPYSTDRVLSVSGVGDAIHIAVYY
LSLLLNDHQDVLKKHKVILYNPANYRPEGGHANDLHQHQRPPRYHQQPPSGLSQYGMNPM
FQNRFDQYQRPPPPHQQHQQQQLLLLHQPQLLQLPYDFSSMFQPAVQPQQPYGGLPPQQA
PPAAAAAIPGAMSSGGGMNPQPYTDEFNNTLIGEVIIHPPLLAGDKYNQDVYVANSLIGS
VIGRGGNNIKHIRENSGCTYVRIEPDKGQSIMLGGRGLTNIRRLTLTGSLESFDKAIYLI
NQRINADRERNSR
Download sequence
Identical sequences A5E5U3
36914.A5E5U3 LELT_04982 XP_001524169.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]