SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36914.A5E5V4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36914.A5E5V4
Domain Number 1 Region: 150-655
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.48e-164
Family Calponin-homology domain, CH-domain 0.00000000000463
Further Details:      
 
Domain Number 2 Region: 7-89,173-194
Classification Level Classification E-value
Superfamily EF-hand 0.00000000141
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36914.A5E5V4
Sequence length 661
Comment (Lodderomyces elongisporus)
Sequence
MNVLKLQKKFPVLQQSDLFNIIEDFRSIDVDDKGWVEKKDVINSVSKKGEYSYDQARETL
KHVDVDASGHVELDDYVELIAKLKESSLDDDGSNDHSSGRGNNLATPSAGGAPGPLSPGR
VKKTAPPIPTANAKNKTYIEGKTSGTTHTINDEERTEFTRHINSVLENDAEIGDRLPFDT
ETFQIFDECRDGLVLSKLINDSVPDTIDTRVLNLPKKGKKQLNNFQMSENANIVINSAKA
IGCVVVNVHSEDIIDGKEHLILGLIWQIIRRGLLSKVDIKYHPELYRLLEDDETLEQFLR
LPPEQILLRWFNYHLKNAGSQRRVTNFGKDVSDGENYTVLLHQLKPDVCDLSPLQTSDLT
ARAEQVLDNADKIGCRKYLTPKSLVSGNPKLNLAFVANLFNTHPGLDPIEEHEQVEIEDF
DAEGEREARVFTLWLNSLDVDPPVISLFEDLKDGLVLLQAYDKVLPGSVSFKHVNKKPAN
GGEVSRFKALENTNYGVEIGKANGFSLVGIDGSDIVDGNKLLTLGLVWQLMRRNIINTLS
ELGNGGQLSDADILKWSNQQVAKNPSKSASTIRSFKDSSLSNGVYLLDVLNGLKPGYVDY
DMVYQGSNLSDEEKYANAKLAISIARKLGALIWLVPEDINEVRSRLILSFVGSLMAVAEG
K
Download sequence
Identical sequences A5E5V4
LELT_04993 XP_001524180.1.59662 36914.A5E5V4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]