SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_Genewise1_v1.C_LG_XIV3313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_Genewise1_v1.C_LG_XIV3313
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-44
Family GABARAP-like 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_Genewise1_v1.C_LG_XIV3313
Sequence length 119
Comment (Populus trichocarpa)
Sequence
MAKSSFKMEHPLERRQAEAARIREKYPDRIPVIVERAEKSDVPDIDKKKYLVPADLTVGQ
FVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMSYSGENTFGVY
Download sequence
Identical sequences A0A2K1XW97
XP_011047257.1.28252 XP_011047258.1.28252 XP_011047260.1.28252 3694.estExt_Genewise1_v1.C_LG_XIV3313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]