SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_kg.C_LG_II0004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_kg.C_LG_II0004
Domain Number 1 Region: 80-155
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.15e-32
Family Skp1 dimerisation domain-like 0.0000239
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily POZ domain 4.45e-22
Family BTB/POZ domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_kg.C_LG_II0004
Sequence length 157
Comment (Populus trichocarpa)
Sequence
MSSSRKFTLKSSDGEAFEVDEAVALESQTIKHMIEEDCADNAIPLPNVTSKILSKVIEYC
KKHVETPKSDDRPSSADDDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVAD
MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A9PDK8
3694.estExt_fgenesh4_kg.C_LG_II0004 XP_002301954.1.11743 XP_011034986.1.28252 POPTR_0002s02020.1|PACid:18245411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]