SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_pg.C_1400043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_pg.C_1400043
Domain Number 1 Region: 431-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-119
Family Motor proteins 0.000000915
Further Details:      
 
Domain Number 2 Region: 47-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-23
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  3694.estExt_fgenesh4_pg.C_1400043
Domain Number - Region: 315-428
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000141
Family FCH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_pg.C_1400043
Sequence length 1129
Comment (Populus trichocarpa)
Sequence
MPHETNHGSLFTSPCKNLRGLRGLIPSNEACYPDEIINDRELAQRKAEEAASRRYQAADW
LRQMDKGASRTLPKEPSEEEFCLALRNGLILCNVLNKVNPGAVLKVVPNLTVQSTEGAAQ
SAIQYFENMRNFLVAVKDMKLLTFEASDLEKGGSSSKVVDCILCLKGYYEWKQAGGIGVW
RYGGLIKIESFQKGSPSSLVGSESADESVDESESSQYEQVLEFLHLSSEVSIEETKTANA
LAFLFDHFGLRLLQAYLQEINGIEELPLNGMVIDTLLRKAVKDFSALLVSQGTQLGLFLK
KILKGDIGSLSKNEFIEAISQYLRQRASLASSDFSKFCICGGKRETIQHTVSSSSGHTEV
IDLHQKQLEDLRFYYKEMRRQVKQIQADWEEEVSRLEQHIRDLEVASSSCHQVLEENRQL
YNQVQDLKGTIRVYCRVRPFLRGQSNGQSTVDYIGENGNIMIVNPLKNGKEARKVFSFNK
VFGTNVTQEQIYADTQPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTSEQTWGVNYR
ALRDLFQISTTRGDVIRYEVGVQMVEIYNEQVRDLLVSDGSNRRLDIRNNSQLNGLNVPD
ASWIPVSSTQDVLDLMKIGQRNRAVGATALNERSSRSHSVLTVHVYGKELVSGSILKGCL
HMVDLAGSERVDKSEAVGERLKEAQHINRSLSALGDVISALAQKSPHVPYRNSKLTQVLQ
DSLGGHAKTLMFVHINPELNSIGETISTLKFAERVASVELGAARSNKETGEIRELKEEIS
NLKEALERKEAEIEQIKGGSTRSTAESQRTRAVSPFYVPRYGASANLKSETSHRPIDDSR
SSEARSCSSGKQRRSSFPSSLTDKETLPRIPFLGEERLASSTKPRSPSPPVRRSTSTDRG
ALSRSRVKERVENQPVARVPFPAIVPVNKSIAAIPVIPSADNSSKGPYIGSQEALKQDNI
SKAFYNLQKVSTRKYYPEHEEEQCRQALNIRQGGIKKSKNESKVKAKNQMPAKFHEVDVG
TTMLSDIDAGEKIEEPRKSDSSEPENERLLPVSPTIGALMVKKLQMNFSKNSQNLEPRVV
QVVEPLLAGKLENKLPNNVTRNAKEAGNTSMPEFRRSRSTPRGKFTILP
Download sequence
Identical sequences B9N5N8
XP_006377968.1.11743 POPTR_0011s16800.1|PACid:18231556 3694.estExt_fgenesh4_pg.C_1400043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]