SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_pg.C_LG_III1884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_pg.C_LG_III1884
Domain Number 1 Region: 180-260
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 281-311
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000131
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 100-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000128
Family CCCH zinc finger 0.0027
Further Details:      
 
Domain Number 4 Region: 39-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000798
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_pg.C_LG_III1884
Sequence length 316
Comment (Populus trichocarpa)
Sequence
MEFGGGHRKRGRLDAAFNGNGGHKKTRQEMESFSTGIGSKSKPCTKFFSTSGCPFGEGCH
FLHYVPGGYKAVSQMLPALPPASRNQGAPPPSFPDRSSPPSVKSRLCNKYNTVEGCKFGD
KCHFAHGEWELGKASAASYDDPRAMGPMQGRAAAPYDDPRAMGPMQGRMSRHMEHPHQGH
GAAASFGSSATTKISIDASLAGAIIGKNGVNSKHICRATGAKLSIREHETDPKKRNIELE
GSFDQISQASDMVRQLISNVGQASGPPMKNSSMHSSGGSNNFKTKICENFNKGSCTFGDR
CHFAHGAEELRKSGMP
Download sequence
Identical sequences 3694.estExt_fgenesh4_pg.C_LG_III1884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]