SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_pg.C_LG_XVII0041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_pg.C_LG_XVII0041
Domain Number 1 Region: 30-102
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 649-717
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 3 Region: 384-470
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 4 Region: 132-211
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000862
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 5 Region: 295-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000158
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_pg.C_LG_XVII0041
Sequence length 722
Comment (Populus trichocarpa)
Sequence
MPDPNPNYPNGSSANKRSKPQPSASAAPLPVPSGHVSFRLLCHASRIGGVIGKAGNIIKG
LQQQTGAKVRIEDAPSDSPDRVITVIGPITQSAVVFSRIESAVEVSKGQEALVRVFERIL
EVAAESDSVADGVVSCRMLAEVSSVGAVIGKGGKVVEKIRKDCGCRIKVLVDKLPDCAAS
NEEMIEIEGDVSAVKKGLVAVSRCLQDCQPVDKTRVTNSKPAEAVSRVSLSDVRVEIHPR
HSAVLPTIAQNSSVLPTIPQHSLGLPTIPKSSINYASRVHPLSLESDRVVTPDTNIPQQL
VFRILCTTDRIGGVIGKGGNIVRALQNETGAAISVGPTVSECDERLITVTASENPESRYS
AAQKTIVLVFSRAVESGIEKGLDPGSSRGSPVTARLVVSPSQVGCLLGKGGTIISEMRKA
TSTSIRIIVGDQRNPKCVPETDHVVEISGDFVNVKDAIYHVTGRLRDNLFSGMLSTPGAR
SNSSVLAEISPYVKLMDPVRDSSWEPVRDPLRDAFRDPLREPVRDPFRETVRDPFREPVR
DPFREPVRDLFREPVRDPLREPARDSAPYIMQPTPGNSHNLSRQTVITQNMDHLGLSHSL
DRPPSPRLWASQTIPRVNPRGISDVSRRLPSLKAGLELGSGGKSAFVTNTTVEIVVPENA
FGSVYGENGSNLARLRQISGAKVIVHEPRLGTSDRIVVISGTPDETQAAQSLLQAFILTG
QS
Download sequence
Identical sequences 3694.estExt_fgenesh4_pg.C_LG_XVII0041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]