SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_pg.C_LG_XVIII0149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_pg.C_LG_XVIII0149
Domain Number 1 Region: 222-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00097
Further Details:      
 
Domain Number 2 Region: 139-213
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_pg.C_LG_XVIII0149
Sequence length 312
Comment (Populus trichocarpa)
Sequence
MADESTYSTATDTTPPSSNKRKFDDQSAPPPSTRRQTGFSSPISDPAPPPSYNSVPPPVD
EIQMAKQKAQEIAARIMSGAGADIKRPRAENGASGFDSVESNKGFSSAPPDMKSTISNSA
PSSIPASYGSYPGGSGLSKKIDVPQGRVGVIIGKGGETIKYLQLQSGAKIQVTRDMDADP
NSPYRIVELMGTPEQIAKAEQLINDVLAEADAGGSGTISRRYAGQGGSEHFSMKIPNNKV
GLVIGKGGDSIKNMQARSGARIQVIPLHLPPGDTSTERTVHIEGTSEQVEAAKQLVNEVT
SEELLPFVVLEH
Download sequence
Identical sequences 3694.estExt_fgenesh4_pg.C_LG_XVIII0149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]