SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_pm.C_280159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_pm.C_280159
Domain Number 1 Region: 138-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.59e-32
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_pm.C_280159
Sequence length 281
Comment (Populus trichocarpa)
Sequence
MSGLYNPNFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPTCSRLLNQEIFR
VSGMMSNQGFGDFDRLRHRSPSPMASSNLLSNVGGTGLSGWNGIPQERLSGPPGMTMDWQ
GAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSI
KDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDFI
KRQQLRELAMLNSNFREESPGPSGSVSPFNTSGMKRAKTGR
Download sequence
Identical sequences B9MTT7
XP_006381266.1.11743 POPTR_0006s11210.1|PACid:18210962 3694.estExt_fgenesh4_pm.C_280159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]