SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_fgenesh4_pm.C_LG_II0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_fgenesh4_pm.C_LG_II0347
Domain Number 1 Region: 82-194
Classification Level Classification E-value
Superfamily POZ domain 1.57e-26
Family BTB/POZ domain 0.0068
Further Details:      
 
Weak hits

Sequence:  3694.estExt_fgenesh4_pm.C_LG_II0347
Domain Number - Region: 19-45
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0471
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_fgenesh4_pm.C_LG_II0347
Sequence length 273
Comment (Populus trichocarpa)
Sequence
MRGHLCTASRVDTECETDSDSETMRCISCKEYYSRCDAGTCKECYEEASDTEEELKREIE
DLKAKVAFLRFWSPLDLHITHRSPAGPCFTDVVLIASSDDGFIGTPSVPVPAHKAVLVSR
SPVFKAMLENEMEESRSGTIKISDVSYDALRSFVNYLYTAEACLDEQMACDLLVLAEKYE
VKHLKAYCEKFLVSKLNWDNSVMSYAFAHQHNAKHMLETALSLITDNMDKLTKRKEYIEL
VEEDPRLVVEIYEAYLSKQVNTAAHKDSSSMKP
Download sequence
Identical sequences B9GTY8
3694.estExt_fgenesh4_pm.C_LG_II0347 POPTR_0002s07750.1|PACid:18246649 XP_002300959.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]