SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00002046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00002046
Domain Number 1 Region: 46-192
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.16e-41
Family Dual specificity phosphatase-like 0.000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00002046
Sequence length 208
Comment (Populus trichocarpa)
Sequence
MKIVHTSAANGDDTIYKTIEVAVIDRRDLTPPPVFPFPVVGDELNLIPPLNFAMVDNGIF
RSGFPDSVNFSFLQTLGLRSIICLCPEPYTEATTEFLKDGGIRLYQFGIESYKEPFVNIP
QDTIREALQVVLDVKNHPILIHCKRGKHRTGCLVGCLRKLQKWCLSSIFDEYQRFAVAKA
RISDQRFMELFDVSTLKHLPMSFSCLKR
Download sequence
Identical sequences 3694.eugene3.00002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]