SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00002565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00002565
Domain Number 1 Region: 121-619
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.04e-165
Family Calponin-homology domain, CH-domain 0.00000000000084
Further Details:      
 
Domain Number 2 Region: 14-95
Classification Level Classification E-value
Superfamily EF-hand 0.0000684
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00002565
Sequence length 661
Comment (Populus trichocarpa)
Sequence
MSGYVGILVSDPWLQNQFTQVELRSLKTHFMSMRRESGKLTLRDLASRMSRLKVVGENLT
EEDRAACIQDLYQNLDEEVDFEFFLKVYLKLHAHASARTGSVAKNSSAFLKAATTTLLHT
ISESEKASYVAHINNYLGEDDFLKKYLPIDPSTNDLFEIAKDGVLLCKLINVAVAGTIDE
RAINTKRILNPWERNENHTLCLNSAKAIGCTVVNIGTQDFIEGRRHLVLGMISQIIKIQL
LADLNLKKTPQLLELVDDSKDVEELMSLPPEKILLRWMNFLLKKAGYKKIVTNFSSDVKD
AEAYAHLLNVLAPEYSNPSTLTVKDPLTRAKLVLEHADRMGCKRYLTAKDIVEGSPNLNL
AFVAHIFQHRNGLSTQTKQISFLETLPDDTQISREERAFRFWMNSLGNSTYIDNVFEDLR
NGWLLLETLDKVSPGIVNWKVANKPPIKLPFRKVENCNQVVKIGKQLKFSLVNIAGNDIV
QGNKKLILAYLWQLMRYNILQLLKNLRFHSHGKEITDADILQWANTKVSNSGTQSRMKSF
KDKSLSDGIFFLELLSAVQPRAVNWSLVTKGVTDDEKKMNATYIISIARKLGCSIFLLPE
DLTEVNQKMILTLTASIMYWYLKQPVDQDKSSGTSDSETISNSTLDDSASESSIEENGNL
T
Download sequence
Identical sequences 3694.eugene3.00002565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]