SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00071222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00071222
Domain Number 1 Region: 127-199
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 255-307
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 16-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000881
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  3694.eugene3.00071222
Domain Number - Region: 350-397
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000131
Family Prokaryotic type KH domain (KH-domain type II) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00071222
Sequence length 404
Comment (Populus trichocarpa)
Sequence
MQHHQKHHRHKRPPRQPLIELQPGQVAFRVVCHASKIGALIGHSGSVISQIRLETGCLVH
CEEAVKGSEHRAIVVAGSASPERKIAVGEDETVEVSAAQEAVVRVLERMWEVDAVKDGGD
CEGYCGLLANTSQIGAVVGREGRNIKRMKRASGAHIWILPAPLCALKEDQLIQITGSSTV
AVKKAVIAITSCLQDCPPYEKDEVDLSLEAVRRRRSGSSGDPHAEFFPHLCSLLPTYSEN
IATDKDHKKPNEQLQVQFRMICPHGAAGSIIGKGGSVVRALQNQTGASIILAPPITNSDG
RLVTVSALENLESSHSPAQNALLLVFARSIEHDIERARSLGLIEEITVTATLLLPSNRVS
CLIERGGRIDSEMIETTGADIQILQGDQFFYCASNNDVVLQVQF
Download sequence
Identical sequences 3694.eugene3.00071222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]