SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00101906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00101906
Domain Number 1 Region: 29-72,102-171
Classification Level Classification E-value
Superfamily Subtilisin-like 4.32e-22
Family Subtilases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00101906
Sequence length 219
Comment (Populus trichocarpa)
Sequence
MSSVVSVFPNRKKKLHTTRSWDFMGFSQEVQRTNVENNIIVGMLDTGIWPESESFNDAGF
GPPPSKWKGSCQVSSNFSCNNKIIGAKYYRSDGMFNQSDVKSPRDSEGHGTHTASIAAGG
SVSMASLYGLALGTARGGVPSARIAVYKECWSDGCWDADILAAFDDEKKNNNIFLSKKHM
EKQLIVNTPNTSIIFEYFFFKNHKINKKKYCRRTISSHI
Download sequence
Identical sequences 3694.eugene3.00101906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]