SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00110438 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00110438
Domain Number 1 Region: 301-360
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000022
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 32-89
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000522
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 142-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00110438
Sequence length 363
Comment (Populus trichocarpa)
Sequence
MVESGKRSRPQRDYDGDTNNQKRHKDDKGTNNDGLIVYRILCPDGVIGSVIGKSGKVINS
IRHESRARVKVVDPFPGAKDRIITIYCHIKEKEDVDVDDDFNHTNPLCAAQDALLKVHAA
ISNAVASLGDSDKRLRDKEECQILVPASQSANIIGKAGATIKRLRSKTRTSIKIIAKDST
DPTHSCAMDFDNFLLITGESEAVKKALFAVSAIMYKFNPKEEIPLEATVPEPPPSIIIPS
DVPIYQPGGFYPNAEPIVSSRSVPPILGATHIPELQGYGDMGSSWPVYTSTLPVVPSFGN
VSRYEELIIRVLCPFDKIGRVIGKGGSTIKSIRQASGARIEVDDTKADRDECIITVTATE
RCC
Download sequence
Identical sequences 3694.eugene3.00110438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]