SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00120795 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00120795
Domain Number 1 Region: 77-151
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.58e-23
Family Skp1 dimerisation domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 10-71
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000279
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00120795
Sequence length 154
Comment (Populus trichocarpa)
Sequence
MACSETTTKVLKLKTSDNEVVEVEEKAALQSEIIKSMVEDGHSTDDAIPLFKVEKKTLAK
IVEWLKKHASDASKDELDKWDADFLDVDTDFLYDLLLASNYLSIEVLLGQLTQKVADMIT
RNQPIKIRELFNIKNDFTPEEKEEILKEKSWLFN
Download sequence
Identical sequences B9I3F9
3694.eugene3.00120795 XP_002318676.1.11743 POPTR_0012s08880.1|PACid:18229876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]