SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00130946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00130946
Domain Number 1 Region: 73-212
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000183
Family DNase I-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00130946
Sequence length 212
Comment (Populus trichocarpa)
Sequence
MDAMGGDTDGEQTDKELTSTILTTPQTLNSTERETVNQLAIKARDSLEKKKKGSKASSKK
NKKSGSSPGGTSRGLNDPIKHSELRRLIHQERIALFGLVETRVKDKNKDNVSQLLLRSWS
FLYNYDFSYRGRISVCWNADTVKVDVFGMSDQAIHVSVTILATNISFNTSIIYGDNNASL
REALWSDIVSRSDGWESTPWILMGDFNAIRNQ
Download sequence
Identical sequences 3694.eugene3.00130946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]