SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00150124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00150124
Domain Number 1 Region: 186-274
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 84-136
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 3 Region: 603-681
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 428-516
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000942
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 5 Region: 351-407
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000319
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00150124
Sequence length 686
Comment (Populus trichocarpa)
Sequence
MERSRSKRNYYYDHQDYDNDNLNNNNNNNMVRTKPRYNNNNNYYRQRGQGGNNMFNNNNN
RFSRTQQQQQPPQQQQDPSSTLMVTTSYRILCHDMKAGGVIGKSGSIIKSIRQHTGAWIN
VHELIPGDEERIIEISDTRRRDPEGRMPSFSPAQEALFLIHDRILENDLQYGVVSSGAGG
FEEDEYVGRGGNRVATRLVVSRMHVGCLLGKGGKIIEQMRMETKTQIRILPRDHTLPRCV
SVSEEIVQVIGDVNAVKNAVAIISSRLRESQHRDRSHFHGRVQSPERFLDDDYVPHMNTR
RSSMDGPPSFGSRLSGPNYRNNNYSSRAPGFPVDAGADPNADSAQPFYVEDLVFRILCPI
DKVNRVVGESDGLVDLLQNEIGVDVKVADPVSGSDEQIITICSEEGPDDELFPAQEALLH
IQTRIVDLVADKDNIITTRLLVPSSEIGCLEGRDGSLSEMESLTGATIEILPKEMLPTYL
SGTDELVQIQGEVKAARDALVEVTSRLRSYLYKDVFQKDLPPTVSAPGPAGTAGGLQAAS
SNNPTPAREGHSGGDPPATYQNVQSASTPQPSKDARGSSAETVKQNESEHREDLPPPTMN
RIPVTLVTRSILEVVIPEPAVPKLITKSKNKLAQISELSGANVTLVEDRPDVTEKIIQIS
GTPEQAERAQSLLQGFILSIQEDGPA
Download sequence
Identical sequences 3694.eugene3.00150124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]