SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00150544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00150544
Domain Number 1 Region: 8-78
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.22e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00150544
Sequence length 79
Comment (Populus trichocarpa)
Sequence
MRCEGKSWKVMLSSPTCPVLEALGKKLSFEIAVGLNGRVWVKADSPSTVIIVVNAIIKSE
SLSGAQQKIMAEKLLQKIQ
Download sequence
Identical sequences B9IER1
POPTR_0015s08670.1|PACid:18232914 3694.eugene3.00150544 XP_002321594.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]