SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00160401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00160401
Domain Number 1 Region: 163-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 250-281
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000013
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 91-123
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000968
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 36-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000419
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00160401
Sequence length 286
Comment (Populus trichocarpa)
Sequence
MMDTRKRGRPDFGTNGYGGFKKSKQEMDSLSTGVGSKSKPCTKFFSTAGCPFGESCHFLH
HVPGGYKAVAQMVNLGPTVALPPVPNSSAPSAVKSRLCKKYNSAEGCKFGDKCHFAHGEW
ELGKAFVPSHNDPHAAGSVPGRLGGRVEPPPPGPATSFGVFATTTRISVDASLAGSIIGK
AGVHSKQICRQTGIKLSIKDHETNPNLKNIELEGSLEQIAQASKMVEELVRVTSANAAAK
SSGGHANPGSNYKTKLCDNFAKGSCTFGQRCHFAHGAAELRKSSMV
Download sequence
Identical sequences 3694.eugene3.00160401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]