SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00161358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00161358
Domain Number 1 Region: 138-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-32
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00161358
Sequence length 281
Comment (Populus trichocarpa)
Sequence
MSGLYNPSFSPARAASPQIRSTPDVDSQYLSELLAEHQKLGPFMQILPICSRLLNQEIFR
VSGMMSNQGFGDFDRLRHRSPSPMASSNLISNVGGTGLGGWNGLPQERLSGPPGMTMDWQ
GAPASPSSFTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSI
KDPDKEEKLKGRPGYEHLNDPLHILIEADLPANIVDIRLRQAQEIIEELLKPVDESQDFI
KRQQLRELAMLNSNFREESPGPSGSVSPFNTSGMKRAKTGR
Download sequence
Identical sequences 3694.eugene3.00161358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]