SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00190658 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00190658
Domain Number 1 Region: 132-246
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.98e-21
Family Matrix metalloproteases, catalytic domain 0.0007
Further Details:      
 
Domain Number 2 Region: 48-120
Classification Level Classification E-value
Superfamily PGBD-like 1.37e-18
Family MMP N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00190658
Sequence length 248
Comment (Populus trichocarpa)
Sequence
MAPKLSHLLSAILVIFSIQSFRGQARTLKPEHRQSFSSFLQGLEGIQKGQTVEGLIELKQ
YLKKFGYYPSDITLTSSDFDDHLELALKTYQEYFHLNVTGNLDSSTIQQMMIPRCGMPDI
INTPSAKPNSTKSKHKKVHVVAHYAFGAQKWPPSKYALTYRFGSGVQVVGSDTLRSVCSK
AFQTWAKVSKFTFREATGGASADIVIEFFSGDHGDQSPFDGPGNQLAHAFYPQDGRLHYD
ADENWSTX
Download sequence
Identical sequences 3694.eugene3.00190658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]