SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00400144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00400144
Domain Number 1 Region: 249-328
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 48-123
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000912
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 148-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00400144
Sequence length 357
Comment (Populus trichocarpa)
Sequence
MAQPWELQLNPSPPGTELPKLNALPVTAKRRRDDFDGGETSAAKRQARADVIFRIVVPSG
KIGKVIGKQGHRIQKIREDTKATIKIADAVARHEERVIIISSKENENGATDAENALQRIA
ELILNEDDGGSSAGGGVEIGKLVNAGHVAANTIRLLIAGSQAGSLIGMSGQNIVKLRNSS
GAMITVLAPNQLPLCASAYESDRVVQISGDVPVVLKALEEIGCQLRENPPKQVISISPSY
NYSAVPFQQYAPQAAADYVTMEMMVPETMMGGLIGRSGSNISRIRVESGAVIKVHGGKGA
QKHRHIQLAGSSQQVALAKQRVDEYIYSQLVQQAGTQQYDEAGMAKIFVRLSRLHIC
Download sequence
Identical sequences B9MVB1
3694.eugene3.00400144 POPTR_0014s04450.1|PACid:18223138 XP_006375108.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]