SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00700273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00700273
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-35
Family Toll/Interleukin receptor TIR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00700273
Sequence length 148
Comment (Populus trichocarpa)
Sequence
MKHDVFISFRGTDTRYSFTSHLYDALQRKQIDAYIDDKLDGGEKIEPAILERIEESFISA
VIFSENYADSTFCLRELSKILECMETKQQMVLPVFYRLDPCQVQNLTGSYGDALCKHEKD
CGSKEVESWRHASKEIANLKGWNSNVIK
Download sequence
Identical sequences A0A2K1R8L9
3694.eugene3.00700273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]