SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.01230085 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.01230085
Domain Number 1 Region: 150-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 385-467
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 3 Region: 33-98
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000759
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 4 Region: 302-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000179
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.01230085
Sequence length 563
Comment (Populus trichocarpa)
Sequence
MDGNRRKYFKKPGNNLFKRKGVSSSRKGKWSDSHGEECSGDGDTVYRILCPSRKIGGVIG
KGGNIVKALREETQSKITVADSVQGSDERVIIIYSSSDKPPRKMDGDEGLPAGNGQQEAF
EPHCAAQDALLKVHDRIVEEDLFGGMASDDDNDNNVVTARLLVPNNMVGCVLGKRGDVIQ
RLRSETGANIRVLPADHLPSCAMDTDELVQISGKPAVAKRALYEISILLHQNPRKDKLPS
VPMPYGGRTFHPPSDSMANMLPPGNPMWPHRNSTPHSMPWMGEYGNHPSEFGPGGFNGVP
PGHGREPSAEFSMKILCSTGKIGGVIGKGGSNVKIVQQETGASIHVEDASAESEERAIRV
SAFEGLWNPRSQTIDAILQLQDKTSDFSEKGMIITRLLVPSSKVGCILGQGGQVINEMRR
RLQADIRVYPKNDKPKCASDDEELVQISGNYGVAKDALAEIASRLRARTLRDANAGTEPG
PAGPVPGFGPARNLPGRGPQPSGMMAASSSGGYEPLRVISVTCSCSFYVYCVTYRLSVCD
KLINKGYRLFLLGVIVFLPRSGQ
Download sequence
Identical sequences B9N229
3694.eugene3.01230085 POPTR_0005s15690.1|PACid:18207581 XP_006383459.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]