SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.84290001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.84290001
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000471
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.84290001
Sequence length 103
Comment (Populus trichocarpa)
Sequence
MITRLLVPSSKVGCILGQGSQDINEMRRLQAEICVYPKNEKPKCASEDEELVQISGNYGV
AKDVLVDIASDSEQELCMMKMLEQNLSVLDLSRALGWHTTCQE
Download sequence
Identical sequences B9P8N2
3694.eugene3.84290001 XP_006384200.1.11743 POPTR_0004s09930.1|PACid:18225380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]