SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_III001054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_III001054
Domain Number 1 Region: 506-841
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-111
Family Motor proteins 0.00000122
Further Details:      
 
Domain Number 2 Region: 28-128
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000144
Family Calponin-homology domain, CH-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_III001054
Sequence length 1133
Comment (Populus trichocarpa)
Sequence
MSASPERSLSENGRYDSSNGAHADVNIQSVIEWLNRSLPHLNLPTDASEEKLRAYLIDGT
VLCNILDKLCPGLVEMRGNSKPGPENIRKFLAAMDEIALPRFVLADIQEGYMEPVLQCLG
TLKTHFEFTGGKESIREHLRRRWNLPKVEFSEGITNSLVYTATCDENPAINGDERQQDSF
ENKYGSSLDDSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSNGFDQNAS
TRTLFSLVNRILEENIERKNGHVHHMALILKKVVQVIEHRVSTQAVNLKDLNNLYEVHLG
KCQSRIKVLETLAAGTTEEIQVLLSKLQQIKIEKTKIEKKKKLEEQELLRTRQERIHSDI
ENSTLKHELEIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSE
SKYQRWKSKEGTYKSFIDYQSRALQELRGASDFLKHEILKTKRSYAEEFNFLGVKLKGLV
DAAANYHSVLAENRRLYNEVQDLKGNIRVYCRIRPFLPGQSKKRTTVEYIGENGELVISN
PSKQGKDSHRLFKFNKVFGPAATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYTM
SGPNITSQEDWGVNYRALHDLFQISQHRKSSISYEVGVQMVEIYNEQVRDLLSSDDVLEL
MNIGLMNRAVGATVLNERSSRSHSVLTVHVYGMDLETGAVLRGNLHLVDLAGSERVDRSE
AIGERLREAQHINKSLSALGDVIFSLAQKSQHVPFRNSKLTQVLQSSLGGQAKTLMFVQL
NPDVDSYSETVSTLKFAERVSGIELGAAKSNKEGRNTRELMEQVAFLKDTISRKDEVIER
LQQLKANVNGVKCGMNSHGYDSSSPRRYSNGTALHSPRLSGRKGSRLFEKASSDTDNCSE
HSERRSEAGSAQSMDNFQHKKMLLPQSKSKDDLTLKKEFVSRPNFVGTCLSHKDKEDLDL
LGFGDADSDERLSDISDGCLSRAETEGSLGSAVEFTLFPESKPSEATKPVEVAKPVEAAK
PARKAANKKPSFVSRLPKPSQKLAQTRLPRLSTTISSASKASSRHVGMLLLLTLILAAIT
LHLQWCPMLLIISVDSPSAFFFLERYVSSQETSCKQFLCNQAGETMALKVKEF
Download sequence
Identical sequences B9GWJ1
XP_002304498.1.11743 POPTR_0003s12790.1|PACid:18216449 3694.fgenesh4_pg.C_LG_III001054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]