SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_IV000774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_IV000774
Domain Number 1 Region: 86-170
Classification Level Classification E-value
Superfamily TRAF domain-like 8.67e-19
Family MATH domain 0.0025
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000883
Family MATH domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_IV000774
Sequence length 175
Comment (Populus trichocarpa)
Sequence
MILNPNGKKKEDGNSHISLFLAMTDPDDVSLDWEMKMEWGFIELLSHDTLRDASNGFLVD
DRSIFGVEVFGVRPGEGESLSFVKEPANGLYTWKISNFSALNKYNHFSEGFTVEGRKWIL
QLYPEGDSNASGTHLSLYLSLDDSETLQTTRKLYIKCLLRIKDTINGSHYEIIGL
Download sequence
Identical sequences 3694.fgenesh4_pg.C_LG_IV000774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]