SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_VI001612 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_VI001612
Domain Number 1 Region: 27-244
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.09e-40
Family DnaQ-like 3'-5' exonuclease 0.0023
Further Details:      
 
Domain Number 2 Region: 303-376
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_VI001612
Sequence length 378
Comment (Populus trichocarpa)
Sequence
MASSSSSSSHQTRVPFPSDPGGKPLDHDVPIHVVTEPSQLPVEFLNPSAAKQLIIGFDCE
GVNLCRHGALCIMQLAFPDAIYLVDAINGGESLIKVCKPALESSYITKVIHDCKRDSEAL
YFQFGIKLHNVVDTQIAYSLIEEQEGRTRLPGDYISFVGLLADPRYCGVSYLEKEEVRVL
LRQDPMFWTYRPLSEMMIRAAADDVRFLLCIYYKMMEKLNERSLWYLAVRGALYSRCFCI
NENNYADWPDIPPIPGFMFYQPIHSALLLVSQSSWNRVTNSVDLHDLFWMDFVKEDNLNI
EDNAPEEEILYVLDVPPGKMGRVIGRRGASILSIKQSCNAEIFFGGAKGPPDKAFIIGPV
KQVRKAEAMLKGKMVDIY
Download sequence
Identical sequences B9HE01
3694.fgenesh4_pg.C_LG_VI001612 POPTR_0006s25040.1|PACid:18213994 XP_002308585.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]