SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_XII000834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_XII000834
Domain Number 1 Region: 77-152
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.09e-26
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 10-71
Classification Level Classification E-value
Superfamily POZ domain 8.63e-17
Family BTB/POZ domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_XII000834
Sequence length 155
Comment (Populus trichocarpa)
Sequence
MASSETTTKVLKLKTSDNEVFEVEEKAALQSGIIKSMVEDGYGTDDAIPLFNVEKKTLAK
IVEWLKKHASDASKDELEKWDADFVDVDTDSLYDLLLASNYLSVEVLLGQLVQKVADMIK
GKQPEEIRKLFNIKNDFTPEEEEEIRKDNAWAFKL
Download sequence
Identical sequences A0A2K1YAW1
3694.fgenesh4_pg.C_LG_XII000834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]