SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_LG_XVII000411 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_LG_XVII000411
Domain Number 1 Region: 134-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 366-441
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000608
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 278-334
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000166
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 38-97
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000665
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_LG_XVII000411
Sequence length 531
Comment (Populus trichocarpa)
Sequence
MAGQRNSYGKRAHSQSDYDIGGNKRRNSGDDRERFVIDSQDTVYRYLCPARKIGSIIGRG
GEIIKQLRIDTKSKIRVGETVPGCEERVVTIYSPSDETNEYEDSGNYISPAQDALFRVHD
KVIAEDLQVEDDSEGSPQVTAKLLVPSDQIGCIIGKGGQIVQNIRSETGAVIRILKDEHL
PPCALSSDELVQISGEAAVLKKALYQIASRLHDNPSRSQHLLVSAVPNVYSSVGSLVGPS
AAAPIVGIAPLMGPYGGFKGDTGDWSRSLYSAPRDELASKEFSLRVVCPTANIGAVIGKG
GTIINQIRQESGATIKVDSSVAEGDDCLITISAKEIYDHYSPTIEAAVRLQPRCSEKMER
DSGLISFTTRLLVPSSRIGCLLGKGGAIIDEMRKLTKAIIRIPRKENLPKVASDDDEMVQ
IAGDLDVAKDALIQISRRLRANVFDREGAMSAILPVLPYLPVSAEGSEGLNYDSRDGKRH
GRGSSYAGGYSSSDYASGDGYGSYGSSQINASGGPYGAYGSYSSGRTGTSG
Download sequence
Identical sequences 3694.fgenesh4_pg.C_LG_XVII000411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]