SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_scaffold_142000034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_scaffold_142000034
Domain Number 1 Region: 19-88
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0054
Further Details:      
 
Weak hits

Sequence:  3694.fgenesh4_pg.C_scaffold_142000034
Domain Number - Region: 123-186
Classification Level Classification E-value
Superfamily ACT-like 0.0915
Family Glycine cleavage system transcriptional repressor 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_scaffold_142000034
Sequence length 218
Comment (Populus trichocarpa)
Sequence
MVENFGGTVIMESSSNISSTKTERKIIEKNRRNQMKTLYSKLNSLLPNQNFKEPQPLPDQ
IDEAISHIKSLEEKLKKAKEKKEGLTSSRKRSYTCTYDPMPIASPKPPQLKIQELGSALE
IVLTSGPDNQFLFYEIIRILHEEGVEVVSANFQVLGDSIFQVLHAQMKESDNGFGAAKVT
ERLNMFINGSTSEIELDLELWDFEIHPGISGELLTGLE
Download sequence
Identical sequences B9N5W4
XP_006376476.1.11743 3694.fgenesh4_pg.C_scaffold_142000034 POPTR_0013s13340.1|PACid:18221696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]