SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pm.C_LG_XII000094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pm.C_LG_XII000094
Domain Number 1 Region: 160-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 2 Region: 57-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 3 Region: 572-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 403-490
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 5 Region: 325-382
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000471
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pm.C_LG_XII000094
Sequence length 655
Comment (Populus trichocarpa)
Sequence
MDRSRSKRNYYYDHQDYDNDNLNNNNMTRTTKPRYNNNNNNNYYRHRGQGGNNMFNNNNN
SYRILCHDMKAGGVIGKSGSIIKSIRQHTGAWINVHELIPGDEERIIEISDTRRRDPEGR
MPSFSPAQEALFLIHDRILENDLQYGVVSSGVGGLEEDEYVGRGGNRVATRLVVSRMHVG
CLLGKGGKIIEQMRMETKTQIRILPRDHTLPRCVSMSEEIVQVVGDVSAVKNAVAIISSR
LRESQHRDRSHFHGRVHSPERLFDDDYAPHMNTRRSSMDGPPSFGSRVPGSNYRNNNYSS
RASGFAADAGADPIADSAQPFYVEDLVFRILCPIDKLNRVVGESDGIVDLLQNEIGVDVK
VADPVSGSDEQIITIFSEEGPDDELFPAQEALLHIQTRIVDLVPDNDHITTTRLLVRSSE
IGCLEGRDASLSEIERLTGATIEILPKEKLPSYLSGIDEIVQIEGEIRAARDALVEVTSR
LRSYIYKDVFEKDLPPPVSAPGLAGGMQAASPSPTPAREGPIGGDPPASYQNVQSAATPQ
PSKDARGSSVEAVKQNESERREELPVTTMNRIPVTLVTRSTLEVVIPEPAVPKLITKSKN
KLAQISELSGANVTLVEDRPDVKEKIIKISGTPEQAERAQSLLQGFILSTQEDGP
Download sequence
Identical sequences 3694.fgenesh4_pm.C_LG_XII000094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]