SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0019031201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.0019031201
Domain Number 1 Region: 77-133
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 2 Region: 169-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000692
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0019031201
Sequence length 245
Comment (Populus trichocarpa)
Sequence
MKKKKKITGSSSVAIKKAVIDVTSCLQDCPPYEKDEVDLSLGAGRRRRSGSSGEPMCSLL
PTYSENIATDGDHKKPNEQSQVQFRMICSHGAAGRIIGTGGSVVRALQNQTGASIIFARP
ITNSDDRLVTVSALENLESSHSPAQNALLLVFARSIEHDIERARSLGLIEEITVTATLLL
PSNKVYCLIGRGGRVDSEMIETTGADIQIMQGDQFFDLASKNDAVVQVQFLSSYFFLLVF
KLLRH
Download sequence
Identical sequences 3694.grail3.0019031201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]