SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0023002901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.0023002901
Domain Number 1 Region: 106-154
Classification Level Classification E-value
Superfamily HMG-box 0.0000000524
Family HMG-box 0.0064
Further Details:      
 
Weak hits

Sequence:  3694.grail3.0023002901
Domain Number - Region: 16-59
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0357
Family PhnA zinc-binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0023002901
Sequence length 189
Comment (Populus trichocarpa)
Sequence
MSSCIDAVPNEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNIWSVNMAAAFQSL
SWQDQVQASNYNSHDYRIDLGSSSKCNNKISMRTPAANIVTQERVVNRPPEKRQRVPSAY
NQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLETNNQTKVDDGSEKRLM
SRSALQNNS
Download sequence
Identical sequences 3694.grail3.0023002901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]