SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0035001101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.0035001101
Domain Number 1 Region: 119-169
Classification Level Classification E-value
Superfamily HMG-box 0.0000000511
Family HMG-box 0.0075
Further Details:      
 
Weak hits

Sequence:  3694.grail3.0035001101
Domain Number - Region: 21-69
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00255
Family Putative zinc binding domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0035001101
Sequence length 212
Comment (Populus trichocarpa)
Sequence
MASSSAAFSPDHLSSSDQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLFSVNMR
SLLPAANQFYLGHGFFNPQINILEGMRSTGAPPSLMINQPNPNESVMPIRGVEEIPKPPV
VNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQ
PVKKTNVRQQEGEDVLMKDGFFAPANVGVTPY
Download sequence
Identical sequences B9IBX2
XP_002320712.1.11743 3694.grail3.0035001101 POPTR_0014s06210.1|PACid:18222425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]